Communicate with Supplier? Supplier
Anson Mr. Anson
What can I do for you?
Contact Supplier
HENAN BON INDUSTRIAL(CHEMICAL) CO.,LTD
I agree Bossgoo.com will authorize the transaction payment on Bossgoomall.com. Bossgoomall.com is a subsidiary of Bossgoo.com group, Please rest assured to trade.
I agree
Home > Products > UV-Curing Materials > Photoinitiators > Exendin-4 CAS 141758-74-9

Exendin-4 CAS 141758-74-9

Payment Type:
L/C,T/T,D/P,Paypal,Money Gram,Western Union
Incoterm:
FOB,CFR,CIF,EXW,FCA,CPT,CIP
Min. Order:
10 Gram
Delivery Time:
7 Days
Transportation:
Ocean,Land,Air,DHL,TNT
Port:
Shanghai port,Qingdao port
Share:
  • Product Description
Overview
Product Attributes

Model No.TF-3398

BrandTianfu

Supply Ability & Additional Informations

PackagingAs Buyer's Request

Productivity100Ton

TransportationOcean,Land,Air,DHL,TNT

Place of OriginChina

Supply Ability50Ton

CertificateISO

PortShanghai port,Qingdao port

Payment TypeL/C,T/T,D/P,Paypal,Money Gram,Western Union

IncotermFOB,CFR,CIF,EXW,FCA,CPT,CIP

Delivery Time7 Days

Packaging & Delivery
Selling Units:
Gram
Package Type:
As Buyer's Request
Product Name: Exendin-4
Synonyms: EXENDIN-4;M.W. 4186.61 C184H282N50O60S;H-HIS-GLY-GLU-GLY-THR-PHE-THR-SER-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2;HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2;Exenatide, AC 2993, Exendin A, ExendinA;Exendin-4 Exenatide;Exenatide (Exendin-4)
CAS: 141758-74-9
MF: C184H282N50O60S
MW: 4186.57188
EINECS: 686-356-3
Product Categories: Peptide;Cytokines Growth Factors and Hormones (Obesity);ExendinPeptides for Cell Biology;GLP-1 Receptor LigandsCell Signaling and Neuroscience;LizardObesity Research;Obesity Peptides;-;Other Obesity Research Products;Hormones;Obesity Research;Toxins and Venoms;Glucagon receptor and related;Peptide Receptors
Mol File: 141758-74-9.mol
Exendin-4 Structure
Exendin-4 Chemical Properties
RTECS VT9545000
storage temp. −20°C

Product Categories : UV-Curing Materials > Photoinitiators

Email to this supplier
  • *To:
    Mr. Anson
  • *Message:
    Your message must be between 20-8000 characters
Related Products List

Home

Phone

Skype

Inquiry